Web Hosting | Domain Register | Dedicated Server | Semi-dedicated | VPS

ENGLISH SPANISH ITALIAN
About Us Services Client Area Support WebMail Contact
HOMEPAGE SITEMAP EMAIL
EUROPEANWEBHOST.COM - SERVICES

Throughout the wide internet market, Europeanwebhost is well known for the variety and professional quality of the services offered to its customers.
The main services offered by our qualified team of experts are:

WEB HOSTING

Europeanwebhost can satisfy every demand with four Windows and Linux hosting packages. Our hosting plans, created to meet the most basic needs, are proven successes and have led competitor companies to mimic our solutions.

Our Windows hosting and Linux hosting solutions are ideal for a professional and secure service.
Every web space has a full control panel: HELM, in the case of Windows hosting and PLESK in the case of Linux hosting.
The control panel allows you to control and maintain every aspect of your site including mail boxes, ftp accounts, databases, protected folders, permissions, installing ready made scripts and applications.
Our target is to provide high quality hosting solutions at low cost allowing our customers to be autonomous.

PROTECT YOUR PRIVACY

Every owner of a domain name must provide personal information like name, address, phone number and email address. All the information is kept in a public access database. Europeanwebhost offer are customers to purchase together with the domain name the option ‘WHOIS data protection’ in order to hide personal data from unwanted eyes. In this way all data regarding the registrant, technical, admin and billing information of the domain you own, visible in a normal WHOIS, will be different from yours.

NOTE: the option ‘WHOIS data protection’ can not be applied to every domain.

DNS MANAGEMENT or URL FORWARDING

Any domain name registration like .it - .com - .net - .org - .biz - .info - .eu, includes a control panel to manage (administrate) DNS and URL forwarding giving the possibility to direct the domain and email to an other web space.
The price of the redirect+dns hosting includes domain name registration and maintenance with the following extension .it - .com - .net - .org - .biz - .info - .eu

WEB SITES AND PORTALS CREATION

Europeanwebhost has a group of Web Development Experts able to design, create and develop web sites and portals using the latest technologies and respecting the worldwide web standards.
All our sites are designed professionally by professionals.

You can take a look at some of our most recent projects:

If you need a website and you want an immediate estimate please feel free to contact us here.

TEXT EDITING

Europeanwebhost also provides a text editing service for any type or category, integrating the contents with original information adapting to various needs. Our web writers are professionals trained to create contents in tune with what is the state-of-the-art as well as introducing new ideas to attract and retain the readers attention.

You can take a look at some of our works

Our prices for text editing are arranged by line numbers and characters:
(The prices and word count are to be considered flexible)

13 lines (counted with word*: font times new roman, size 12 – about 1.300 characters with spaces) 3.50 euros.
20 lines (counted with word*: font times new roman, size 12 – about 1.990 characters with spaces) 5.40 euros.
30 lines (counted with word*: font times new roman, size 12 – about 3.000 characters with spaces) 8.00 euros.

If you want an immediate estimate please feel free to contact us here.

* For MS Office, you can use the tool ‘Word Count’ in the Tools menu

TEXT TRANSLATION

Europeanwebhost also provides text translation in Italian, English, Spanish and German with the help of mother tongue speakers and specialist translators.

Our prices for text translating are arranged by the different categories of translation:
(The prices and page count are to be considered flexible)

English Package
4 euros every page* (from English to Italian)
6 euros every page* (from Italian to English)

French Package
4 euros every page* (from French to Italian)
7 euros every page* (from Italian to French)

Spanish Package
4 euros every page* (from Spanish to Italian)
7 euros every page* (from Italian to Spanish)

German Package
4 euros every page* (from German to Italian)
7 euros every page* (from Italian to)

If you want an immediate estimate please feel free to contact us here.

*A page consists in 1.500 characters (with spaces) or 15 lines (font Times New Roman, size 12).

 

windows_server_2003centos
aspnetaspfpphpmysqlperlphpmyadmin
Europeanwebhost.com di Daniele Frasca,
Sede operativa Roma - P.IVA: 07816031004 - cell. +39 328.39.34.897 - Fax +39 06.972.566.33