Web Hosting | Domain Register | Dedicated Server | Semi-dedicated | VPS

ENGLISH SPANISH ITALIAN
About Us Services Client Area Support WebMail Contact
HOMEPAGE SITEMAP EMAIL
EUROPEANWEBHOST.COM - ABOUT US

Started by a group of internet specialists, we have always focused our main target on our customers’ satisfaction.
Whatever your needs are, we are always able to offer you the best solutions in the least possible time, benefiting from the latest and more advanced technologies available today on the NET.
Professionalism, quality and reliability, are what distinguish Europeanwebhost from other web hosting providers.
Our customer is always a satisfied customer.

Europeanwebhost offers you a variety of plans in order to satisfy all your requirements.
Every webmaster will find what he needs in our services thanks to our choice of Operating Systems, microsoft® windows server 2003 and linux centos, and our server-side assortment of scripting languages, asp 3, asp.net v1 e v2, php 4.x e 5.x.

Our servers are maintained by an American enterprise server farm connected through optical fibre cables with the major world backbones, supported by h24 real-time monitoring.

Besides our normal windows and linux hosting plans, Europeanwebhost is able to offer reseller plans to satisfy every retailer request. And for who is still not satisfied with the convenience of our reseller plans, Europeanwebhost offers multiple (frazionabili) –fraction- Windows and Linux plans totally easy to configure.

If you need any help or you don’t see any plan that meets your needs, please contact us here.

windows_server_2003centos
aspnetaspfpphpmysqlperlphpmyadmin
Europeanwebhost.com di Daniele Frasca,
Sede operativa Roma - P.IVA: 07816031004 - cell. +39 328.39.34.897 - Fax +39 06.972.566.33